PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010907212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family BES1
Protein Properties Length: 309aa    MW: 33500.5 Da    PI: 8.7985
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010907212.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222121.5e-6541522145
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl...eeaeaagssasaspess 93 
                     g+gr ptwkErEnnkrRERrRRai aki+ GLR qGnyklpk++DnneVlkALc+eAGwvve+DGttyr+g+kp+     ++++g+s+++sp+ss
  XP_010907212.1   4 GGGRLPTWKERENNKRRERRRRAIGAKIFYGLRTQGNYKLPKHCDNNEVLKALCAEAGWVVEEDGTTYRRGCKPPpppLDTATGGQSTNISPCSS 98 
                     89************************************************************************98666778899********** PP

          DUF822  94 lq.sslkssalaspvesysaspksssfpspssldsislasa.asllpvlsvlsl 145
                     ++ +s+ ss+++spv+sy+asp sssfpsp++l++ ++a + + llp+l+ ls+
  XP_010907212.1  99 SHhLSPPSSSFPSPVPSYHASPLSSSFPSPTRLENSNHAVNpSYLLPFLRKLST 152
                     *99*****************************9987776555999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.6E-634151IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MASGGGRLPT WKERENNKRR ERRRRAIGAK IFYGLRTQGN YKLPKHCDNN EVLKALCAEA  60
GWVVEEDGTT YRRGCKPPPP PLDTATGGQS TNISPCSSSH HLSPPSSSFP SPVPSYHASP  120
LSSSFPSPTR LENSNHAVNP SYLLPFLRKL STLPPLRISN SAPVTPPLSS PTASHPTKLR  180
KLEWDYAAFH HPQFAASAPA SPTRGCRHGH PATIPECDES DASTVDYGRW FSFHMTAPAS  240
PSFNLVNPVL QMPETVAGAG GGGTSERGRG GMEFEFENER VKPWVGERIH EVGVEDLELT  300
LGVGSSGSK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010907212.10.0PREDICTED: protein BZR1 homolog 1-like
SwissprotB8B7S51e-106BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI961e-106BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLM0TKT71e-127M0TKT7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P26010_0011e-126(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-72BES1 family protein